MAP3K6 polyclonal antibody (A01)
  • MAP3K6 polyclonal antibody (A01)

MAP3K6 polyclonal antibody (A01)

Ref: AB-H00009064-A01
MAP3K6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MAP3K6.
Información adicional
Size 50 uL
Gene Name MAP3K6
Gene Alias ASK2|MAPKKK6|MGC125653|MGC20114
Gene Description mitogen-activated protein kinase kinase kinase 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HFWLHFLLQSCQPFKTACAQGDQCLVLVLEMNKVLLPAKLEVRGTDPVSTVTLSLLEPETQDIPSSWTFPVASICGVSASKRDERCCFLYALPPAQDVQLC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAP3K6 (AAH15914, 225 a.a. ~ 325 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9064

Enviar uma mensagem


MAP3K6 polyclonal antibody (A01)

MAP3K6 polyclonal antibody (A01)