PAPSS2 monoclonal antibody (M07), clone 2A8
  • PAPSS2 monoclonal antibody (M07), clone 2A8

PAPSS2 monoclonal antibody (M07), clone 2A8

Ref: AB-H00009060-M07
PAPSS2 monoclonal antibody (M07), clone 2A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PAPSS2.
Información adicional
Size 100 ug
Gene Name PAPSS2
Gene Alias ATPSK2|SK2
Gene Description 3'-phosphoadenosine 5'-phosphosulfate synthase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq DPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKKAMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAPSS2 (NP_004661, 513 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9060
Clone Number 2A8
Iso type IgG1 Kappa

Enviar uma mensagem


PAPSS2 monoclonal antibody (M07), clone 2A8

PAPSS2 monoclonal antibody (M07), clone 2A8