SLC7A7 monoclonal antibody (M04), clone 3B10
  • SLC7A7 monoclonal antibody (M04), clone 3B10

SLC7A7 monoclonal antibody (M04), clone 3B10

Ref: AB-H00009056-M04
SLC7A7 monoclonal antibody (M04), clone 3B10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC7A7.
Información adicional
Size 100 ug
Gene Name SLC7A7
Gene Alias LAT3|LPI|MOP-2|Y+LAT1|y+LAT-1
Gene Description solute carrier family 7 (cationic amino acid transporter, y+ system), member 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq RVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC7A7 (NP_003973.2, 462 a.a. ~ 511 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9056
Clone Number 3B10
Iso type IgG2b Kappa

Enviar uma mensagem


SLC7A7 monoclonal antibody (M04), clone 3B10

SLC7A7 monoclonal antibody (M04), clone 3B10