SLC7A7 purified MaxPab mouse polyclonal antibody (B01P)
  • SLC7A7 purified MaxPab mouse polyclonal antibody (B01P)

SLC7A7 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009056-B01P
SLC7A7 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SLC7A7 protein.
Información adicional
Size 50 ug
Gene Name SLC7A7
Gene Alias LAT3|LPI|MOP-2|Y+LAT1|y+LAT-1
Gene Description solute carrier family 7 (cationic amino acid transporter, y+ system), member 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MVDSTEYEVASQPEVETSPLGDGASPGPEQVKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYSGWDTLNYVTEEIKNP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SLC7A7 (AAH03062.1, 1 a.a. ~ 511 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9056

Enviar uma mensagem


SLC7A7 purified MaxPab mouse polyclonal antibody (B01P)

SLC7A7 purified MaxPab mouse polyclonal antibody (B01P)