PRC1 monoclonal antibody (M01), clone 3E3-1G1
  • PRC1 monoclonal antibody (M01), clone 3E3-1G1

PRC1 monoclonal antibody (M01), clone 3E3-1G1

Ref: AB-H00009055-M01
PRC1 monoclonal antibody (M01), clone 3E3-1G1

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PRC1.
Información adicional
Size 100 ug
Gene Name PRC1
Gene Alias ASE1|MGC1671|MGC3669
Gene Description protein regulator of cytokinesis 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MRRSEVLAEESIVCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEESLKERLIKSISVCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMPHYDIDSASVPSLEELNQFRQHVTTLRETKASRREEFVSIKRQIILCMEELDHTPDTSFERDVVCEDEDAFCLSLENIATLQKLLRQLEMQKSQNEAVCEGLRTQIRELWDRLQIPEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRC1 (AAH03138.1, 1 a.a. ~ 620 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9055
Clone Number 3E3-1G1
Iso type IgG1 kappa

Enviar uma mensagem


PRC1 monoclonal antibody (M01), clone 3E3-1G1

PRC1 monoclonal antibody (M01), clone 3E3-1G1