Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
AIP monoclonal antibody (M02), clone 3D3
Abnova
AIP monoclonal antibody (M02), clone 3D3
Ref: AB-H00009049-M02
AIP monoclonal antibody (M02), clone 3D3
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant AIP.
Información adicional
Size
100 ug
Gene Name
AIP
Gene Alias
ARA9|FKBP16|FKBP37|SMTPHN|XAP2
Gene Description
aryl hydrocarbon receptor interacting protein
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
KVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYE
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
AIP (NP_003968.1, 156 a.a. ~ 249 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
9049
Clone Number
3D3
Iso type
IgG1 Kappa
Enviar uma mensagem
AIP monoclonal antibody (M02), clone 3D3
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*