SH2D2A MaxPab rabbit polyclonal antibody (D01)
  • SH2D2A MaxPab rabbit polyclonal antibody (D01)

SH2D2A MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00009047-D01
SH2D2A MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SH2D2A protein.
Información adicional
Size 100 uL
Gene Name SH2D2A
Gene Alias F2771|TSAd
Gene Description SH2 domain protein 2A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MEFPLAQICPQGSHEAPIPTFSTFQITDMTRRSCQNLGYTAASPQAPEAASSTGNAERAEEVPGEGSLFLQAETRAWFQKTQAHWLLQHGAAPAWFHGFITRREAERLLEPKPQGCYLVRFSESAVTFVLTYRSRTCCRHFLLAQLRDGRHVVLGEDSAHARLQDLLLHYTAHPLSPYGETLTEPLARQTPEPAGLSLRTEESNFGSKSQDPNPQYSPIIKQGQAPVPMQKEGAGEKEPSQLLRPKPPIPAKPQL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SH2D2A (NP_003966.1, 1 a.a. ~ 389 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9047

Enviar uma mensagem


SH2D2A MaxPab rabbit polyclonal antibody (D01)

SH2D2A MaxPab rabbit polyclonal antibody (D01)