SEMA5A polyclonal antibody (A01)
  • SEMA5A polyclonal antibody (A01)

SEMA5A polyclonal antibody (A01)

Ref: AB-H00009037-A01
SEMA5A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SEMA5A.
Información adicional
Size 50 uL
Gene Name SEMA5A
Gene Alias FLJ12815|SEMAF|semF
Gene Description sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PSFMEDNSRFSHVAVDVVQGREALVHIIYLATDYGTIKKVRVPLNQTSSSCLLEEIELFPERRREPIRSLQILHSQSVLFVGLREHVVKIPLKRCQFYRTRSTCIGA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEMA5A (NP_003957, 393 a.a. ~ 499 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9037

Enviar uma mensagem


SEMA5A polyclonal antibody (A01)

SEMA5A polyclonal antibody (A01)