CCRL2 purified MaxPab rabbit polyclonal antibody (D01P)
  • CCRL2 purified MaxPab rabbit polyclonal antibody (D01P)

CCRL2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009034-D01P
CCRL2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CCRL2 protein.
Información adicional
Size 100 ug
Gene Name CCRL2
Gene Alias CKRX|CRAM-A|CRAM-B|FLJ55815|HCR|MGC116710
Gene Description chemokine (C-C motif) receptor-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPYN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CCRL2 (NP_003956.2, 1 a.a. ~ 344 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9034

Enviar uma mensagem


CCRL2 purified MaxPab rabbit polyclonal antibody (D01P)

CCRL2 purified MaxPab rabbit polyclonal antibody (D01P)