View larger
Mouse monoclonal antibody raised against a partial recombinant BAZ1B.
AB-H00009031-M01A
New product
BAZ1B monoclonal antibody (M01A), clone 5E9
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 200 uL |
| Gene Name | BAZ1B |
| Gene Alias | WBSCR10|WBSCR9|WSTF |
| Gene Description | bromodomain adjacent to zinc finger domain, 1B |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | ELISA |
| Immunogen Prot. Seq | MDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQKK |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | BAZ1B (NP_075381, 1384 a.a. ~ 1483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 9031 |
| Clone Number | 5E9 |
| Iso type | IgG2a Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant BAZ1B.