CH25H polyclonal antibody (A01)
  • CH25H polyclonal antibody (A01)

CH25H polyclonal antibody (A01)

Ref: AB-H00009023-A01
CH25H polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CH25H.
Información adicional
Size 50 uL
Gene Name CH25H
Gene Alias C25H
Gene Description cholesterol 25-hydroxylase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVPAR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CH25H (NP_003947, 206 a.a. ~ 272 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9023

Enviar uma mensagem


CH25H polyclonal antibody (A01)

CH25H polyclonal antibody (A01)