CLIC3 purified MaxPab mouse polyclonal antibody (B01P)
  • CLIC3 purified MaxPab mouse polyclonal antibody (B01P)

CLIC3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009022-B01P
CLIC3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CLIC3 protein.
Información adicional
Size 50 ug
Gene Name CLIC3
Gene Alias -
Gene Description chloride intracellular channel 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CLIC3 (NP_004660.2, 1 a.a. ~ 236 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9022

Enviar uma mensagem


CLIC3 purified MaxPab mouse polyclonal antibody (B01P)

CLIC3 purified MaxPab mouse polyclonal antibody (B01P)