CDKL2 monoclonal antibody (M01), clone 1F6
  • CDKL2 monoclonal antibody (M01), clone 1F6

CDKL2 monoclonal antibody (M01), clone 1F6

Ref: AB-H00008999-M01
CDKL2 monoclonal antibody (M01), clone 1F6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDKL2.
Información adicional
Size 100 ug
Gene Name CDKL2
Gene Alias KKIAMRE|P56
Gene Description cyclin-dependent kinase-like 2 (CDC2-related kinase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq LKDCSNVSVDHTRNPSVAIPPLTHNLSAVAPSINSGMGTETIPIQGYRVDEKTKKCSIPFVKPNRHSPSGIYNINVTTLVSGPPLSDDSGADLPQMEHQH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDKL2 (NP_003939, 394 a.a. ~ 493 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8999
Clone Number 1F6
Iso type IgG1 Kappa

Enviar uma mensagem


CDKL2 monoclonal antibody (M01), clone 1F6

CDKL2 monoclonal antibody (M01), clone 1F6