LIMD1 monoclonal antibody (M01), clone 2G5
  • LIMD1 monoclonal antibody (M01), clone 2G5

LIMD1 monoclonal antibody (M01), clone 2G5

Ref: AB-H00008994-M01
LIMD1 monoclonal antibody (M01), clone 2G5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LIMD1.
Información adicional
Size 100 ug
Gene Name LIMD1
Gene Alias -
Gene Description LIM domains containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq VDSENKIYCVRDYHKVLAPKCAACGLPILPPEGSDETIRVVSMDRDYHVECYHCEDCGLELNDEDGHRCYPLEDHLFCHSCHVKRLEKRPSSTALHQH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LIMD1 (NP_055055.1, 577 a.a. ~ 674 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8994
Clone Number 2G5
Iso type IgG2b Kappa

Enviar uma mensagem


LIMD1 monoclonal antibody (M01), clone 2G5

LIMD1 monoclonal antibody (M01), clone 2G5