TRPA1 monoclonal antibody (M03), clone 6G8
  • TRPA1 monoclonal antibody (M03), clone 6G8

TRPA1 monoclonal antibody (M03), clone 6G8

Ref: AB-H00008989-M03
TRPA1 monoclonal antibody (M03), clone 6G8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRPA1.
Información adicional
Size 100 ug
Gene Name TRPA1
Gene Alias ANKTM1
Gene Description transient receptor potential cation channel, subfamily A, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRPA1 (NP_015628, 1033 a.a. ~ 1117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8989
Clone Number 6G8
Iso type IgG1 Kappa

Enviar uma mensagem


TRPA1 monoclonal antibody (M03), clone 6G8

TRPA1 monoclonal antibody (M03), clone 6G8