PLOD3 purified MaxPab mouse polyclonal antibody (B01P)
  • PLOD3 purified MaxPab mouse polyclonal antibody (B01P)

PLOD3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008985-B01P
PLOD3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PLOD3 protein.
Información adicional
Size 50 ug
Gene Name PLOD3
Gene Alias LH3
Gene Description procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MTSSGPGPRFLLLLPLLLPPAASASDRPRGRDPVNPEKLLVITVATAETEGYLRFLRSAEFFNYTVRTLGLGEEWRGGDVARTVGGGQKVRWLKKEMEKYADREDMIIMFVDSYDVILAGSPTELLKKFVQSGSRLLFSAESFCWPEWGLAEQYPEVGTGKRFLNSGGFIGFATTIHQIVRQWKYKDDDDDQLFYTRLYLDPGLREKLSLNLDHKSRIFQNLNGALDEVVLKFDRNRVRIRNVAYDTLPIVVHGN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLOD3 (NP_001075.1, 1 a.a. ~ 738 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8985

Enviar uma mensagem


PLOD3 purified MaxPab mouse polyclonal antibody (B01P)

PLOD3 purified MaxPab mouse polyclonal antibody (B01P)