H1FX purified MaxPab mouse polyclonal antibody (B01P)
  • H1FX purified MaxPab mouse polyclonal antibody (B01P)

H1FX purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008971-B01P
H1FX purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human H1FX protein.
Información adicional
Size 50 ug
Gene Name H1FX
Gene Alias H1X|MGC15959|MGC8350
Gene Description H1 histone family, member X
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MSVELEEALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEGGGERRGAPAAATAPAPTAHKAKKAAPGAAGSRRADKKPARGQKPEQRSHKKGAGAKKDKGGKAKKTAAAGGKKVKKAAKPSVPKVPKGRK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen H1FX (NP_006017.1, 1 a.a. ~ 213 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8971

Enviar uma mensagem


H1FX purified MaxPab mouse polyclonal antibody (B01P)

H1FX purified MaxPab mouse polyclonal antibody (B01P)