KYNU polyclonal antibody (A01)
  • KYNU polyclonal antibody (A01)

KYNU polyclonal antibody (A01)

Ref: AB-H00008942-A01
KYNU polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KYNU.
Información adicional
Size 50 uL
Gene Name KYNU
Gene Alias -
Gene Description kynureninase (L-kynurenine hydrolase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KYNU (NP_003928, 2 a.a. ~ 108 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8942

Enviar uma mensagem


KYNU polyclonal antibody (A01)

KYNU polyclonal antibody (A01)