TOP3B MaxPab mouse polyclonal antibody (B01P)
  • TOP3B MaxPab mouse polyclonal antibody (B01P)

TOP3B MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008940-B01P
TOP3B MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TOP3B protein.
Información adicional
Size 50 ug
Gene Name TOP3B
Gene Alias FLJ39376
Gene Description topoisomerase (DNA) III beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKTVLMVAEKPSLAQSIAKILSRGSLSSHKGLNGACSVHEYTGTFAGQPVRFKMTSVCGHVMTLDFLGKYNKWDKVDPAELFSQAPTEKKEANPKLNMVKFLQVEGRGCDYIVLWLDCDKEGENICFEVLDAVLPVMNKAHGGEKTVFRARFSSITDTDICNAMACLGEPDHNEALSVDARQELDLRIGCAFTRFQTKYFQGKYGDLDSSLISFGPCQTPTLGFCVERHDKIQSFKPETYWVLQAKVNTDKDRSL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TOP3B (NP_003926, 1 a.a. ~ 862 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8940

Enviar uma mensagem


TOP3B MaxPab mouse polyclonal antibody (B01P)

TOP3B MaxPab mouse polyclonal antibody (B01P)