RAB7L1 purified MaxPab rabbit polyclonal antibody (D01P)
  • RAB7L1 purified MaxPab rabbit polyclonal antibody (D01P)

RAB7L1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008934-D01P
RAB7L1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RAB7L1 protein.
Información adicional
Size 100 ug
Gene Name RAB7L1
Gene Alias DKFZp686P1051|RAB7L
Gene Description RAB7, member RAS oncogene family-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAB7L1 (NP_003920.1, 1 a.a. ~ 203 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8934

Enviar uma mensagem


RAB7L1 purified MaxPab rabbit polyclonal antibody (D01P)

RAB7L1 purified MaxPab rabbit polyclonal antibody (D01P)