P11 monoclonal antibody (M01), clone 2H1
  • P11 monoclonal antibody (M01), clone 2H1

P11 monoclonal antibody (M01), clone 2H1

Ref: AB-H00008909-M01
P11 monoclonal antibody (M01), clone 2H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant P11.
Información adicional
Size 100 ug
Gene Name P11
Gene Alias MGC133268|PP11|PRSS26
Gene Description 26 serine protease
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFALYSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKYIATAYIVSST
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen P11 (NP_006016.1, 270 a.a. ~ 369 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8909
Clone Number 2H1
Iso type IgG2a Kappa

Enviar uma mensagem


P11 monoclonal antibody (M01), clone 2H1

P11 monoclonal antibody (M01), clone 2H1