GYG2 monoclonal antibody (M04), clone 3D10
  • GYG2 monoclonal antibody (M04), clone 3D10

GYG2 monoclonal antibody (M04), clone 3D10

Ref: AB-H00008908-M04
GYG2 monoclonal antibody (M04), clone 3D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GYG2.
Información adicional
Size 100 ug
Gene Name GYG2
Gene Alias GN-2|GN2
Gene Description glycogenin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq CDPLSQPSPQPADFTETETILQPANKVESVSSEETFEPSQELPAEALRDPSLQDALEVDLAVSVSQISIEEKVKELSPEEERRKWEEGRIDYMGKDAFARIQEKLDRFLQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GYG2 (NP_003909, 392 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8908
Clone Number 3D10
Iso type IgG2a Kappa

Enviar uma mensagem


GYG2 monoclonal antibody (M04), clone 3D10

GYG2 monoclonal antibody (M04), clone 3D10