AP1M1 polyclonal antibody (A01)
  • AP1M1 polyclonal antibody (A01)

AP1M1 polyclonal antibody (A01)

Ref: AB-H00008907-A01
AP1M1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant AP1M1.
Información adicional
Size 50 uL
Gene Name AP1M1
Gene Alias AP47|CLAPM2|CLTNM|MU-1A
Gene Description adaptor-related protein complex 1, mu 1 subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AP1M1 (NP_115882, 1 a.a. ~ 74 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8907

Enviar uma mensagem


AP1M1 polyclonal antibody (A01)

AP1M1 polyclonal antibody (A01)