AP1G2 polyclonal antibody (A01)
  • AP1G2 polyclonal antibody (A01)

AP1G2 polyclonal antibody (A01)

Ref: AB-H00008906-A01
AP1G2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant AP1G2.
Información adicional
Size 50 uL
Gene Name AP1G2
Gene Alias G2AD
Gene Description adaptor-related protein complex 1, gamma 2 subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RPPENPALLLITITATNFSEGDVTHFICQAAVPKSLQLQLQAPSGNTVPARGGLPITQLFRILNPNKAPLRLKLRLTYDHFHQSVQEIFEVNNLPVESWQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AP1G2 (NP_003908, 686 a.a. ~ 785 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8906

Enviar uma mensagem


AP1G2 polyclonal antibody (A01)

AP1G2 polyclonal antibody (A01)