AP1S2 monoclonal antibody (M01), clone 3B9-G5
  • AP1S2 monoclonal antibody (M01), clone 3B9-G5

AP1S2 monoclonal antibody (M01), clone 3B9-G5

Ref: AB-H00008905-M01
AP1S2 monoclonal antibody (M01), clone 3B9-G5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant AP1S2.
Información adicional
Size 100 ug
Gene Name AP1S2
Gene Alias DC22|MGC:1902|MRX59|SIGMA1B
Gene Description adaptor-related protein complex 1, sigma 2 subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AP1S2 (AAH01117, 1 a.a. ~ 157 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8905
Clone Number 3B9-G5
Iso type IgG2b kappa

Enviar uma mensagem


AP1S2 monoclonal antibody (M01), clone 3B9-G5

AP1S2 monoclonal antibody (M01), clone 3B9-G5