AP1S2 polyclonal antibody (A01)
  • AP1S2 polyclonal antibody (A01)

AP1S2 polyclonal antibody (A01)

Ref: AB-H00008905-A01
AP1S2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant AP1S2.
Información adicional
Size 50 uL
Gene Name AP1S2
Gene Alias DC22|MGC:1902|MRX59|SIGMA1B
Gene Description adaptor-related protein complex 1, sigma 2 subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AP1S2 (AAH01117, 1 a.a. ~ 157 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8905

Enviar uma mensagem


AP1S2 polyclonal antibody (A01)

AP1S2 polyclonal antibody (A01)