MCM3AP monoclonal antibody (M01), clone 1H3
  • MCM3AP monoclonal antibody (M01), clone 1H3

MCM3AP monoclonal antibody (M01), clone 1H3

Ref: AB-H00008888-M01
MCM3AP monoclonal antibody (M01), clone 1H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MCM3AP.
Información adicional
Size 100 ug
Gene Name MCM3AP
Gene Alias FLJ44336|FLJ45306|GANP|KIAA0572|MAP80
Gene Description minichromosome maintenance complex component 3 associated protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq VRVARCCEDVCAHLVDLFLVEEIFQTAKETLQELQCFCKYLQRWREAVTARKKLRRQMRAFPAAPCCVDVSDRLRALAPSAECPIAEENLARGLLDLGHA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MCM3AP (AAH13285, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8888
Clone Number 1H3
Iso type IgG2a Kappa

Enviar uma mensagem


MCM3AP monoclonal antibody (M01), clone 1H3

MCM3AP monoclonal antibody (M01), clone 1H3