TAX1BP1 monoclonal antibody (M01), clone 2C3
  • TAX1BP1 monoclonal antibody (M01), clone 2C3

TAX1BP1 monoclonal antibody (M01), clone 2C3

Ref: AB-H00008887-M01
TAX1BP1 monoclonal antibody (M01), clone 2C3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TAX1BP1.
Información adicional
Size 100 ug
Gene Name TAX1BP1
Gene Alias CALCOCO3|T6BP|TXBP151
Gene Description Tax1 (human T-cell leukemia virus type I) binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DSEDSKEDENVPTAPDPPSQHLRGHGTGFCFDSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TAX1BP1 (NP_006015, 690 a.a. ~ 789 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8887
Clone Number 2C3
Iso type IgG2a Kappa

Enviar uma mensagem


TAX1BP1 monoclonal antibody (M01), clone 2C3

TAX1BP1 monoclonal antibody (M01), clone 2C3