TAX1BP1 polyclonal antibody (A01)
  • TAX1BP1 polyclonal antibody (A01)

TAX1BP1 polyclonal antibody (A01)

Ref: AB-H00008887-A01
TAX1BP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TAX1BP1.
Información adicional
Size 50 uL
Gene Name TAX1BP1
Gene Alias CALCOCO3|T6BP|TXBP151
Gene Description Tax1 (human T-cell leukemia virus type I) binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DSEDSKEDENVPTAPDPPSQHLRGHGTGFCFDSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TAX1BP1 (NP_006015, 690 a.a. ~ 789 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8887

Enviar uma mensagem


TAX1BP1 polyclonal antibody (A01)

TAX1BP1 polyclonal antibody (A01)