DDX18 polyclonal antibody (A01)
  • DDX18 polyclonal antibody (A01)

DDX18 polyclonal antibody (A01)

Ref: AB-H00008886-A01
DDX18 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DDX18.
Información adicional
Size 50 uL
Gene Name DDX18
Gene Alias FLJ33908|MrDb
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 18
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KNYFLHKSAQEAYKSYIRAYDSHSLKQIFNVNNLNLPQVALSFGFKVPPFVDLNVNSNEGKQKKRGGGGGFGYQKTKKVEKSKIFKHISKKSSDSRQFSH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DDX18 (NP_006764, 571 a.a. ~ 670 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8886

Enviar uma mensagem


DDX18 polyclonal antibody (A01)

DDX18 polyclonal antibody (A01)