SGPL1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SGPL1 purified MaxPab rabbit polyclonal antibody (D01P)

SGPL1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008879-D01P
SGPL1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SGPL1 protein.
Información adicional
Size 100 ug
Gene Name SGPL1
Gene Alias FLJ13811|KIAA1252|SPL
Gene Description sphingosine-1-phosphate lyase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFVFQPESLWSRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SGPL1 (NP_003892.2, 1 a.a. ~ 568 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8879

Enviar uma mensagem


SGPL1 purified MaxPab rabbit polyclonal antibody (D01P)

SGPL1 purified MaxPab rabbit polyclonal antibody (D01P)