SGPL1 polyclonal antibody (A01)
  • SGPL1 polyclonal antibody (A01)

SGPL1 polyclonal antibody (A01)

Ref: AB-H00008879-A01
SGPL1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SGPL1.
Información adicional
Size 50 uL
Gene Name SGPL1
Gene Alias FLJ13811|KIAA1252|SPL
Gene Description sphingosine-1-phosphate lyase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DIYRLSNLMTAKGWNLNQLQFPPSIHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAELSSVFLDSLYSTDTVTQGSQMNGSPKPH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SGPL1 (NP_003892, 459 a.a. ~ 568 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8879

Enviar uma mensagem


SGPL1 polyclonal antibody (A01)

SGPL1 polyclonal antibody (A01)