SQSTM1 purified MaxPab mouse polyclonal antibody (B01P)
  • SQSTM1 purified MaxPab mouse polyclonal antibody (B01P)

SQSTM1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008878-B01P
SQSTM1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SQSTM1 protein.
Información adicional
Size 50 ug
Gene Name SQSTM1
Gene Alias A170|OSIL|PDB3|ZIP3|p60|p62|p62B
Gene Description sequestosome 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIEV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SQSTM1 (NP_003891, 1 a.a. ~ 440 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8878

Enviar uma mensagem


SQSTM1 purified MaxPab mouse polyclonal antibody (B01P)

SQSTM1 purified MaxPab mouse polyclonal antibody (B01P)