SPHK1 polyclonal antibody (A02)
  • SPHK1 polyclonal antibody (A02)

SPHK1 polyclonal antibody (A02)

Ref: AB-H00008877-A02
SPHK1 polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SPHK1.
Información adicional
Size 50 uL
Gene Name SPHK1
Gene Alias SPHK
Gene Description sphingosine kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLLRLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGKGVFA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPHK1 (NP_068807, 261 a.a. ~ 353 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8877

Enviar uma mensagem


SPHK1 polyclonal antibody (A02)

SPHK1 polyclonal antibody (A02)