SYNJ2 monoclonal antibody (M02), clone 2H8
  • SYNJ2 monoclonal antibody (M02), clone 2H8

SYNJ2 monoclonal antibody (M02), clone 2H8

Ref: AB-H00008871-M02
SYNJ2 monoclonal antibody (M02), clone 2H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SYNJ2.
Información adicional
Size 100 ug
Gene Name SYNJ2
Gene Alias INPP5H|KIAA0348|MGC44422
Gene Description synaptojanin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,RNAi-Ab
Immunogen Prot. Seq GTKAMKPEAAPLLGDYQDPFWNLLHHPKLLNNTWLSKSSDPLDSGTRSPKRDPIDPVSAGASAAKAELPPDHEHKTLGHWVTISDQEKRTALQVFDPLAK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SYNJ2 (NP_003889, 1396 a.a. ~ 1495 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8871
Clone Number 2H8
Iso type IgG2a Kappa

Enviar uma mensagem


SYNJ2 monoclonal antibody (M02), clone 2H8

SYNJ2 monoclonal antibody (M02), clone 2H8