PER2 polyclonal antibody (A01)
  • PER2 polyclonal antibody (A01)

PER2 polyclonal antibody (A01)

Ref: AB-H00008864-A01
PER2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PER2.
Información adicional
Size 50 uL
Gene Name PER2
Gene Alias FASPS|KIAA0347
Gene Description period homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDDSGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PER2 (NP_073728, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8864

Enviar uma mensagem


PER2 polyclonal antibody (A01)

PER2 polyclonal antibody (A01)