PER3 monoclonal antibody (M01), clone 3A7
  • PER3 monoclonal antibody (M01), clone 3A7

PER3 monoclonal antibody (M01), clone 3A7

Ref: AB-H00008863-M01
PER3 monoclonal antibody (M01), clone 3A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PER3.
Información adicional
Size 100 ug
Gene Name PER3
Gene Alias GIG13
Gene Description period homolog 3 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq WRMIRQTPERILMTYQVPERVKEVVLKEDLEKLESMRQQQPQFSHGQKEELAKVYNWIQSQTVTQEIDIQACVTCENEDSADGAATSCGQVLVEDSC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PER3 (NP_058515.1, 1105 a.a. ~ 1201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8863
Clone Number 3A7
Iso type IgG2a Kappa

Enviar uma mensagem


PER3 monoclonal antibody (M01), clone 3A7

PER3 monoclonal antibody (M01), clone 3A7