View larger
Mouse polyclonal antibody raised against a full-length human APLN protein.
AB-H00008862-B01
New product
APLN MaxPab mouse polyclonal antibody (B01)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 50 uL |
| Gene Name | APLN |
| Gene Alias | XNPEP2 |
| Gene Description | apelin |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr |
| Immunogen Prot. Seq | MSATWCSPEGQGMGQGPGREVGGNSAASGPASPIRDPCLSEAGLKGPPSAHPRRLCLLHRLVCFSGGLTSIQLSPRTCCSHQWAQLFSPACFPQWRAPGCSLDDSRSLTRIRPVHLPGPSLD |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | APLN (AAH21104.1, 1 a.a. ~ 122 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 8862 |
More info
Mouse polyclonal antibody raised against a full-length human APLN protein.