APLN polyclonal antibody (A01)
  • APLN polyclonal antibody (A01)

APLN polyclonal antibody (A01)

Ref: AB-H00008862-A01
APLN polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant APLN.
Información adicional
Size 50 uL
Gene Name APLN
Gene Alias XNPEP2
Gene Description apelin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSATWCSPEGQGMGQGPGREVGGNSAASGPASPIRDPCLSEAGLKGPPSAHPRRLCLLHRLVCFSGGLTSIQLSPRTCCSHQWAQLFSPACFPQWRAPGCSLDDSRSLTRIRPVHLPGPSLD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen APLN (AAH21104.1, 1 a.a. ~ 122 a.a.) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8862

Enviar uma mensagem


APLN polyclonal antibody (A01)

APLN polyclonal antibody (A01)