STK19 purified MaxPab mouse polyclonal antibody (B01P)
  • STK19 purified MaxPab mouse polyclonal antibody (B01P)

STK19 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008859-B01P
STK19 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human STK19 protein.
Información adicional
Size 50 ug
Gene Name STK19
Gene Alias D6S60|D6S60E|G11|HLA-RP1|MGC117388|RP1
Gene Description serine/threonine kinase 19
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MQKWFSAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVPGRACPWREPIRGRRGARPGGGDAGGTPGETVRHCSAPEDPIFRFSSLHSYPFPGTIKSRDMSWKRHHLIPETFGVKRRRKRGPVESDPLRGEPGSARAAVSELMQLFPRGLFEDALPPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTEDYRTRVLKACDGRPYAGAVQKFLASVLPACGDLSFQQDQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STK19 (NP_004188.1, 1 a.a. ~ 364 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8859

Enviar uma mensagem


STK19 purified MaxPab mouse polyclonal antibody (B01P)

STK19 purified MaxPab mouse polyclonal antibody (B01P)