AKAP4 polyclonal antibody (A01)
  • AKAP4 polyclonal antibody (A01)

AKAP4 polyclonal antibody (A01)

Ref: AB-H00008852-A01
AKAP4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant AKAP4.
Información adicional
Size 50 uL
Gene Name AKAP4
Gene Alias AKAP82|FSC1|HI|hAKAP82|p82
Gene Description A kinase (PRKA) anchor protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MMAYSDTTMMSDDIDWLRSHRGVCKVDLYNPEGQQDQDRKVICFVDVSTLNVEDKDYKDAASSSSEGNLNLGSLEEKEIIVIKDTEKKDQSKTEGSVCLF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AKAP4 (NP_003877, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8852

Enviar uma mensagem


AKAP4 polyclonal antibody (A01)

AKAP4 polyclonal antibody (A01)