TSC22D1 monoclonal antibody (M01), clone 1G7
  • TSC22D1 monoclonal antibody (M01), clone 1G7

TSC22D1 monoclonal antibody (M01), clone 1G7

Ref: AB-H00008848-M01
TSC22D1 monoclonal antibody (M01), clone 1G7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant TSC22D1.
Información adicional
Size 100 ug
Gene Name TSC22D1
Gene Alias DKFZp686O19206|MGC17597|RP11-269C23.2|TGFB1I4|TSC22
Gene Description TSC22 domain family, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TSC22D1 (AAH00456, 1 a.a. ~ 144 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8848
Clone Number 1G7
Iso type IgG1 kappa

Enviar uma mensagem


TSC22D1 monoclonal antibody (M01), clone 1G7

TSC22D1 monoclonal antibody (M01), clone 1G7