TSC22D1 purified MaxPab rabbit polyclonal antibody (D01P)
  • TSC22D1 purified MaxPab rabbit polyclonal antibody (D01P)

TSC22D1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008848-D01P
TSC22D1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TSC22D1 protein.
Información adicional
Size 100 ug
Gene Name TSC22D1
Gene Alias DKFZp686O19206|MGC17597|RP11-269C23.2|TGFB1I4|TSC22
Gene Description TSC22 domain family, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TSC22D1 (NP_006013.1, 1 a.a. ~ 144 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8848

Enviar uma mensagem


TSC22D1 purified MaxPab rabbit polyclonal antibody (D01P)

TSC22D1 purified MaxPab rabbit polyclonal antibody (D01P)