KSR polyclonal antibody (A01)
  • KSR polyclonal antibody (A01)

KSR polyclonal antibody (A01)

Ref: AB-H00008844-A01
KSR polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KSR.
Información adicional
Size 50 uL
Gene Name KSR1
Gene Alias KSR|RSU2
Gene Description kinase suppressor of ras 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LDARRESGSGPSTDTLSAASLPWPPGSSQLGRAGNSAQGPRSISVSALPASDSPTPSFSEGLSDTCIPLHASGRLTPRALHSFITPPTTPQLRRHTKLKP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KSR (XP_290793, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8844

Enviar uma mensagem


KSR polyclonal antibody (A01)

KSR polyclonal antibody (A01)