GPR109B purified MaxPab mouse polyclonal antibody (B01P)
  • GPR109B purified MaxPab mouse polyclonal antibody (B01P)

GPR109B purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008843-B01P
GPR109B purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GPR109B protein.
Información adicional
Size 50 ug
Gene Name GPR109B
Gene Alias HM74|PUMAG|Puma-g
Gene Description G protein-coupled receptor 109B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNRHHLQDHFLEIDKKNCCVFRDDFIAKVLPPVLGLEFIFGLLGNGLALWIFCFHLKSWKSSRIFLFNLAVADFLLIICLPFVMDYYVRRSDWKFGDIPCRLVLFMFAMNRQGSIIFLTVVAVDRYFRVVHPHHALNKISNWTAAIISCLLWGITVGLTVHLLKKKLLIQNGTANVCISFSICHTFRWHEAMFLLEFFLPLGIILFCSARIIWSLRQRQMDRHAKIKRAITFIMVVAIVFVICFLPSVVVRIHIF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GPR109B (NP_006009.1, 1 a.a. ~ 387 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8843

Enviar uma mensagem


GPR109B purified MaxPab mouse polyclonal antibody (B01P)

GPR109B purified MaxPab mouse polyclonal antibody (B01P)