PROM1 monoclonal antibody (M08), clone 2F4
  • PROM1 monoclonal antibody (M08), clone 2F4

PROM1 monoclonal antibody (M08), clone 2F4

Ref: AB-H00008842-M08
PROM1 monoclonal antibody (M08), clone 2F4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PROM1.
Información adicional
Size 100 ug
Gene Name PROM1
Gene Alias AC133|CD133|MSTP061|PROML1|RP41
Gene Description prominin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq STLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PROM1 (NP_006008, 693 a.a. ~ 790 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.2
Gene ID 8842
Clone Number 2F4
Iso type IgG2b Kappa

Enviar uma mensagem


PROM1 monoclonal antibody (M08), clone 2F4

PROM1 monoclonal antibody (M08), clone 2F4