PROM1 polyclonal antibody (A01)
  • PROM1 polyclonal antibody (A01)

PROM1 polyclonal antibody (A01)

Ref: AB-H00008842-A01
PROM1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PROM1.
Información adicional
Size 50 uL
Gene Name PROM1
Gene Alias AC133|CD133|MSTP061|PROML1|RP41
Gene Description prominin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq STLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PROM1 (NP_006008, 693 a.a. ~ 790 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8842

Enviar uma mensagem


PROM1 polyclonal antibody (A01)

PROM1 polyclonal antibody (A01)