HDAC3 monoclonal antibody (M03), clone 2A3
  • HDAC3 monoclonal antibody (M03), clone 2A3

HDAC3 monoclonal antibody (M03), clone 2A3

Ref: AB-H00008841-M03
HDAC3 monoclonal antibody (M03), clone 2A3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HDAC3.
Información adicional
Size 100 ug
Gene Name HDAC3
Gene Alias HD3|RPD3|RPD3-2
Gene Description histone deacetylase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA,IF
Immunogen Prot. Seq ISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HDAC3 (NP_003874, 319 a.a. ~ 428 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8841
Clone Number 2A3
Iso type IgG2a Kappa

Enviar uma mensagem


HDAC3 monoclonal antibody (M03), clone 2A3

HDAC3 monoclonal antibody (M03), clone 2A3