HDAC3 MaxPab rabbit polyclonal antibody (D01)
  • HDAC3 MaxPab rabbit polyclonal antibody (D01)

HDAC3 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00008841-D01
HDAC3 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HDAC3 protein.
Información adicional
Size 100 uL
Gene Name HDAC3
Gene Alias HD3|RPD3|RPD3-2
Gene Description histone deacetylase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HDAC3 (NP_003874.2, 1 a.a. ~ 428 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 8841

Enviar uma mensagem


HDAC3 MaxPab rabbit polyclonal antibody (D01)

HDAC3 MaxPab rabbit polyclonal antibody (D01)