WISP2 monoclonal antibody (M09), clone 3D10
  • WISP2 monoclonal antibody (M09), clone 3D10

WISP2 monoclonal antibody (M09), clone 3D10

Ref: AB-H00008839-M09
WISP2 monoclonal antibody (M09), clone 3D10

Información del producto

Mouse monoclonal antibody raised against a full length recombinant WISP2.
Información adicional
Size 100 ug
Gene Name WISP2
Gene Alias CCN5|CT58|CTGF-L
Gene Description WNT1 inducible signaling pathway protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq QLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDCSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen WISP2 (AAH17782.1, 24 a.a. ~ 250 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8839
Clone Number 3D10
Iso type IgG2a Kappa

Enviar uma mensagem


WISP2 monoclonal antibody (M09), clone 3D10

WISP2 monoclonal antibody (M09), clone 3D10